天堂网亚洲,天天操天天搞,91视频高清,菠萝蜜视频在线观看入口,美女视频性感美女视频,95丝袜美女视频国产,超高清美女视频图片

ChemicalBook--->CAS DataBase List--->83930-13-6

83930-13-6

83930-13-6 Structure

83930-13-6 Structure
IdentificationBack Directory
[Name]

GRF (1-44) (HUMAN)
[CAS]

83930-13-6
[Synonyms]

HPGRF
SOMATORELIN
GRF (HUMAN)
GHRH (HUMAN)
HPGRF, HUMAN
GRF Acetate
SOMATOLIBERIN
GHRF (1-44) HUMAN
GHFR (1-44), HUMAN
GHRH (1-44), HUMAN
GRF (1-44) (HUMAN)
GRF(human) Acetate
SERMORELIN (HUMAN)
Somatorelin Acetate
SOMATOCRININ (HUMAN)
SOMATOLIBERIN (HUMAN)
GRF (1-44), AMIDE, HUMAN
GRF (1-44) (HUMAN) USP/EP/BP
GRF (human)|GHRF (1-44), human
M.W. 5039.72 C215H358N72O66S
Growth-hormone-releasing hormone
Human growth hormone-releasing factor
GROWTH HORMONE RELEASING FACTOR, HUMAN
GROWTH HORMONE-RELEASING HORMONE (HUMAN)
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
GROWTH HORMONE RELEASING FACTOR (1-44), HUMAN
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Human growth hormone-releasing hormone (1-44) amide
Growth hormone releasing factor, human, ≥95% (HPLC)
GROWTH HORMONE RELEASING FACTOR (1-44), AMIDE, HUMAN
Growth HorMone Releasing Factor huManGrowth HorMone Releasing Fa
SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin
TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2
H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-OH
H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2
H-Tyr-Ala-Asp-Ala-Lle-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-lys-Leu-Leu-Gln-Asp-Lle-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
GRF (huMan) SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 acetate salt
[Molecular Formula]

C215H358N72O66S
[MDL Number]

MFCD00081671
[MOL File]

83930-13-6.mol
[Molecular Weight]

5039.65
Questions And AnswerBack Directory
[Structure]

GHRH(1–29) is the bioactive core of human GHRH. The N-terminal tyrosine residue with selected aromatic rings is important for the high bioactivity in human and nonrodent mammalian GHRH. The amino acid sequence of GHRH shows higher identities between the human, porcine, bovine, and caprine species, but the rat and mouse are exceptions. The sequence of the C-terminus is highly variable among species while the N-terminus is more conserved. The N-terminal region (1–27) of GHRH is well conserved in nonmammalian vertebrates. Zebrafish GHRH (1–27) shows 74.1%, 81.5%, and 81.5% similarity to the Xenopus tropicalis, chicken, and human counterparts, respectively. Mr 12,447 (GHRH(1-44), Mr 5,039), pI 10.3 (GHRH(1- 44), pI 11.5). Soluble in acidic aqueous solution (e.g., 1% acetic acid). Lyophilized GHRH is stable at room temperature for 2months, and recommended storage is below -18°C with desiccation.
[Gene, mRNA, and precursor]

The human GHRH gene, GHRH, location 20q11.2, consists of five exons. GHRH mRNA has 459 bases that encode a signal peptide of 24 aa residues, a mature protein of 44 aa residues, and a C-peptide of 31 aa residues with unknown function. In nonmammalian vertebrates, the GHRH-like peptide and PACAP were first believed to be encoded by the same gene, but later actual GHRH and PACAP were found to be encoded by two distinct genes.
[Synthesis and release]

The human GHRH gene, GHRH, location 20q11.2, consists of five exons. GHRH mRNA has 459 bases that encode a signal peptide of 24 aa residues, a mature protein of 44 aa residues, and a C-peptide of 31 aa residues with unknown function. In nonmammalian vertebrates, the GHRH-like peptide and PACAP were first believed to be encoded by the same gene, but later actual GHRH and PACAP were found to be encoded by two distinct genes.
[Synthesis and release]

The synthesis and release of GHRH are regulated by sex hormones, aging, the negative feedback effect of GH, and diverse pathological conditions. Gsh-1 has been considered a transcriptional factor of Ghrh expression in the rat hypothalamus. GHRH synthesis is inhibited by somatostatin (SS). The expression levels of the SS receptor, sst2A, in GHRH neurons are higher in female mice than male mice. The production of hypothalamic GHRH is decreased by aging. It is also negatively regulated by the feedback of GH, whereas ghrelin stimulates GHRH release.
[Receptors]

GHRH-R belongs to the GPCR B II subclass, highly selective for GHRH. The GHRH-R of most mammals consists of 423 aa residues. The N-terminal extracellular domain contains a site for N-glycosylation as well as six cysteine residues and an aspartate residue that are conserved in this receptor family. The third intracellular loop and the C-terminal intracellular domain contain several potential phosphorylation sites, which may regulate signaling and receptor internalization. It is mainly expressed in the pituitary.
[Agonists and Antagonists]

Tesamorelin, sermorelin (GHRH(1–29)-NH2), and CJC-1295 are agonists. Antagonists comprise the antibodies or peptides to GHRH-R: JV-1-10, JV-1-36, JV-1-37, JV-1-38, JV-1-39, JV-1-40, JV-1-41, JV-1-42, JV-1-43, JV-1-62, JV-1-63, MZ-4-71, MZ-4-169, MZ-4-181, MZ-4-243, MZ-5-78, MZ-5-156, MZ-5-192, MZ-6-55, [Ac-Tyr1, D-Arg2] GHRH(1–29)-NH2.
[Biological functions]

GHRH receptor mRNA is expressed in several organs, especially in the adrenal, digestive tract, and kidney. The primary function of GHRH is to stimulate GH synthesis and release from the anterior pituitary somatotrophs. GHRH activates cell proliferation, cell differentiation, and growth of somatotrophs, and is also involved in the modulation of appetite and feeding behavior, the regulation of sleeping, the control of jejunal motility, and the increase in leptin levels in modest obesity .
[Clinical implications]

Mutations in the GHRH gene have never been described. A single base change in the GHRH-R gene in human somatotropinoma confers hypersensitivity to GHRH binding. Pit-1 mutation inducing the low gene expression of GHRH-R can lead to the development of dwarfism.
Chemical PropertiesBack Directory
[storage temp. ]

−20°C
[form ]

powder
[color ]

White to off-white
[Water Solubility ]

Water : 25 mg/mL (4.96 mM)
[InChIKey]

JAHCMOSSKRAPEL-IBFVROBCSA-N
Safety DataBack Directory
[WGK Germany ]

3
Hazard InformationBack Directory
[Description]

GHRH is expressed and secreted from the hypothalamic neurons of the arcuate nucleus (ARC). GHRH stimulates the release of growth hormone (GH) in the anterior pituitary. In 1982, three isoforms of GHRH(1–37, 1–40, 1–44 aa residues) were initially isolated from human pancreatic tumors that caused acromegaly, and the latter two were found in the human hypothalamus. The aa sequence of GHRH was also identified in various vertebrates from rodents to fish, including a protochordate. In nonmammalian vertebrates, GHRH-like peptide (pituitary adenylate cyclase-activating polypeptide (PACAP)-related peptide in mammals) was first isolated like GHRH, although the GHRH-like peptide had less activity on GH release. Later, actual GHRH, which was more phylogenetically and structurally similar to mammalian GHRH and showed GH-releasing activity, was isolated in nonmammalian vertebrates.
[Uses]

Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary[1].
[Clinical Use]

Sermorelin, a functional peptide fragment of GHRH (1–29), has been used in the diagnosis and treatment of children with idiopathic growth hormone deficiency. Tesamorelin, a stabilized synthetic peptide analog of GHRH(1–44), received US Food and Drug Administration approval in 2010 for the treatment of lipodystrophy in HIV patients under highly active antiretroviral therapy, and was investigated for effects on certain cognitive functions in adults with cognitive impairment as well as healthy older adults.
[storage]

Store at -20°C
[References]

[1] Fridlyand LE, et al.Growth Hormone-Releasing Hormone in Diabetes.Front Endocrinol (Lausanne). 2016 Oct 10;7:129. eCollection 2016. DOI:10.3389/fendo.2016.00129
83930-13-6 suppliers list
Company Name: Cellmano Biotech Limited
Tel: 0551-65326643 18156095617 , 18156095617
Website: http://www.cellmano.com/
Company Name: Changzhou Xuanming Pharmaceutical Technology Co., Ltd.
Tel: +86-519-85525359 +86-15995072465 , +86-15995072465
Website: https://www.xuanmingchem.com
Company Name: Adachibio Inc.
Tel: +8108027837258 , +8108027837258
Website: www.adachibio.com/
Company Name: Henan Tianfu Chemical Co.,Ltd.
Tel: +86-0371-55170693 +86-19937530512 , +86-19937530512
Website: https://www.tianfuchem.com/
Company Name: career henan chemical co
Tel: +86-0371-86658258 +8613203830695 , +8613203830695
Website: www.coreychem.com/
Company Name: .GZ HONESTCHEM CO.,LTD
Tel: +86-15013270415 +86-15013270415 , +86-15013270415
Website: www.honestchemtop.com
Company Name: Shenzhen Nexconn Pharmatechs Ltd
Tel: +86-755-89396905 +86-15013857715 , +86-15013857715
Website: http://www.approvedhomemanagement.com/ShowSupplierProductsList31188/0.htm
Company Name: Hubei xin bonus chemical co. LTD
Tel: 86-13657291602
Website: www.approvedhomemanagement.com/ShowSupplierProductsList1549548/0.htm
Company Name: BOC Sciences
Tel: +1-631-485-4226
Website: www.bocsci.com/
Company Name: SIMAGCHEM CORP
Tel: +86-13806087780 , +86-13806087780
Website: http://www.simagchem.com/
Company Name: Dideu Industries Group Limited
Tel: +86-29-89586680 +86-15129568250 , +86-15129568250
Website: https://www.dideu.com
Company Name: Baoji Guokang Bio-Technology Co., Ltd.
Tel: 0917-3909592 13892490616 , 13892490616
Website: http://www.gk-bio.com
Company Name: Zhejiang J&C Biological Technology Co.,Limited
Tel: +1-2135480471 +1-2135480471 , +1-2135480471
Website: https://www.sarms4muscle.com
Company Name: Hangzhou Go Top Peptide Biotech
Tel: 0571-88211921
Website: http://www.gotopbio.com/
Company Name: Chengdu Youngshe Chemical Co., Ltd.
Tel: +8618108235634 , +8618108235634
Website: http://www.youngshechem.com/
Company Name: LEAP CHEM CO., LTD.
Tel: +86-852-30606658
Website: www.leapchem.com
Company Name: TargetMol Chemicals Inc.
Tel:
Website: www.targetmol.com/
Company Name: Hebei Miaoyin Technology Co.,Ltd
Tel: +86-17367732028 +86-17367732028 , +86-17367732028
Website: www.approvedhomemanagement.com/manufacturer/hebei-miaoyin-technology-25082/
Tags:83930-13-6 Related Product Information
51110-01-1 74315-46-1 73032-94-7 36635-61-7 86168-78-7 645-96-5 14542-93-9 39687-95-1 2999-46-4 51-43-4 2769-64-4 7188-38-7

  • HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.