天堂网亚洲,天天操天天搞,91视频高清,菠萝蜜视频在线观看入口,美女视频性感美女视频,95丝袜美女视频国产,超高清美女视频图片

ChemicalBook--->CAS DataBase List--->93755-85-2

93755-85-2

93755-85-2 Structure

93755-85-2 Structure
IdentificationBack Directory
[Name]

GASTRIN RELEASING PEPTIDE, HUMAN
[CAS]

93755-85-2
[Synonyms]

GRP
LGALSL
HSPC159
GRP (HUMAN)
PubChem ID: 23185015
Galectin-related protein
GASTRIN RELEASING PEPTIDE
GASTRIN RELEASING AGENT, HUMAN
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
M.W. 2859.40 C130H204N38O31S2
Human gastrin-releasing peptide
GASTRIN RELEASING PEPTIDE, HUMAN
Gastrin-releasingpeptide (human) (9CI)
Human gastrin releasing peptide (1-27)
Recombinant Human LGALSL Protein, His Tag
GRP (human)|Gastrin Releasing Peptide, human
Gastrin releasing peptide, human, ≥97% (HPLC)
ANTI-HSPC159 (CENTER) antibody produced in rabbit
GASTRIN RELEASING PEPTIDE HUMANGASTRIN RELEASING PEPTI
VAL-PRO-LEU-PRO-ALA-GLY-GLY-GLY-THR-VAL-LEU-THR-LYS-MET-TYR-PRO-ARG-GLY-ASN-HIS-TRP-ALA-VAL-GLY-HIS-LEU-MET-NH2
H-VAL-PRO-LEU-PRO-ALA-GLY-GLY-GLY-THR-VAL-LEU-THR-LYS-MET-TYR-PRO-ARG-GLY-ASN-HIS-TRP-ALA-VAL-GLY-HIS-LEU-MET-NH2
GRP, Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
VAL-PRO-LEU-PRO-ALA-GLY-GLY-GLY-THR-VAL-LEU-THR-LYS-MET-TYR-PRO-ARG-GLY-ASN-HIS-TRP-ALA-VAL-GLY-HIS-LEU-MET-LYS(BIOTIN)
L-Val-L-Pro-L-Leu-L-Pro-L-Ala-Gly-Gly-Gly-L-Thr-L-Val-L-Leu-L-Thr-L-Lys-L-Met-L-Tyr-L-Pro-L-Arg-Gly-L-Asn-L-His-L-Trp-L-Ala-L-Val-Gly-L-His-L-Leu-L-Met-NH2
L-Valyl-L-prolyl-L-leucyl-L-prolyl-L-alanylglycylglycylglycyl-L-threonyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-methionyl-L-tyrosyl-L-prolyl-L-arginylglycyl-L-asparaginyl-L-histidyl-L-tryptophyl-L-alanyl-L-valylglycyl-L-histidyl-L-leucyl-L-methioninamide
L-Methioninamide, L-valyl-L-prolyl-L-leucyl-L-prolyl-L-alanylglycylglycylglycyl-L-threonyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-methionyl-L-tyrosyl-L-prolyl-L-arginylglycyl-L-asparaginyl-L-histidyl-L-tryptophyl-L-alanyl-L-valylglycyl-L-histidyl-L-leucyl-
[Molecular Formula]

C130 H204 N38 O31 S2
[MDL Number]

MFCD00133362
[MOL File]

93755-85-2.mol
[Molecular Weight]

2859.38
Questions And AnswerBack Directory
[Discovery]

First isolated from the porcine stomach and named gastrin-releasing peptide (GRP),1 GRP was originally believed to be a mammalian counterpart of the amphibian peptide, bombesin. Its structure has been determined in many mammals, including pigs, rats, mice, guinea pigs, dogs, and humans. In addition, GRP18–27, a possible fragment of mature GRP, was later isolated from the porcine spinal cord and originally called neuromedin C,2 although a more appropriate name is either GRP-10 or GRP18–27. GRP orthologs have been identified in birds, reptiles, amphibians, and teleost fish. On the other hand, it is reported that frogs have both GRP and bombesin, which are genetically distinct peptides, suggesting that GRP is not mammalian bombesin.
GASTRIN RELEASING PEPTIDE, HUMAN
[Structure]

The human GRP precursor consists of 148 aa residues (rat, 147 aa). A predicted preproGRP translation product consists of a signal peptide, GRP1–27, and a C-terminal extended peptide termed proGRP31–125. Most GRP peptides have a common sequence motif, GXHWAVGHLM amide (X=N or S), at their C-terminus. Although the N-terminal sequences are less conserved across vertebrate species, many identified GRP peptides in mammals consist of 27 aa residues, excluding rats and mice (29 aa). In nonmammals, the amphibian GRP peptide consists of 29 aa residues, the reptile peptide of 28 aa residues, and the avian peptide of 27 aa residues while the teleost peptide appears to be shorter (24–25 aa residues).
structure of human GRP precursor
[Gene, mRNA, and precursor]

The human GRP gene is located on chromosome 18 (18q21.32), and consists of three exons (mRNA, 850 bp long ) . Its mRNA produces a 125-aa preproGRP precursor protein. In chickens, the grp gene is located on chromosome Z. In Xenopus, the grp gene is predicted to be located on chromosome 1. In zebrafish, the grp gene is predicted to be located on chromosome 21 (CH211-233A1). GRP mRNA is produced in the CNS, stomach, intestine, pancreas, and lung in humans as well as other mammals. The expression of GRP mRNA is detected in the limbic system, including the amygdala as well as the hippocampus,8 and an overexpression in patients suffering from small cell lung cancer has been reported.
[Synthesis and release]

In the CNS, bombesin or GRP immunoreactivity was detected in approximately 5% of dorsal root ganglion neurons and approximately 10% of trigeminal ganglion neurons. In the brain, abundant GRP immunoreactivity was observed in the cerebral cortex, hypothalamus, and medulla oblongata. In the gastrointestinal tract, abundant GRP-immunoreactive fibers were observed in the stomach, suggesting gastrin release, and the small intestine, colon, and pancreas. In addition, the overexpression of GRP has been demonstrated at both the mRNA and protein levels in various types of tumors, including lung, prostate, breast, stomach, pancreas, and colon.
[Receptors]

GRPR is a GPCR superfamily with a seventransmembrane domain. GRPR is coupled to the Gq protein, and GRPR activation leads to an increase in intracellular Ca2+ and stimulation of the PLC/PKC and ERK/ MAPK pathways. In mammals, bombesin-like peptides act on a family of at least three GPCRs: the GRP-preferring receptor (GRPR), the neuromedin B-preferring receptor (NMBR), and the bombesin receptor subtype-3 (BRS-3), which is considered an orphan receptor at present. Human GRP binds GRPR (BB2 receptor) with a higher binding affinity (Ki of 1.8 - 0.4 nM) than that of NMBR (BB1 receptor) (Ki of 15 - 0.4 nM).
[Agonists and Antagonists]

A fragment of the C-terminal of human GRP, GRP18–27 (GRP-10), is reported to be a selective and potent agonist for GRPR. The central administration of GRP-10 induces many physiological responses, similar to that with mature GRP. RC3095 has been reported as a selective and potent antagonist of GRPR. The central administration of RC-3095 attenuates many physiological responses.
[Biological functions]

GRP functions via GRPR, which is highly expressed in the pancreas, and is also expressed in the stomach, adrenal cortex, and brain. Considerable evidence indicates that GRP plays a role in many physiological processes, including food intake, male sexual functions,circadian rhythms, sigh control, and fear-memory consolidation in the mammalian CNS. In addition, the itch sensation is a major biological function of GRP in mammals. In chicks, GRP functions as an anorexigenic factor in the brain.
[Clinical implications]

GRP and GRPR often excessively express in endocrinerelated cancer cells such as small cell lung cancer, prostate cancer, and gastrointestinal tract cancer. ProGRP is known to be a specific tumor marker for the small cell lung cancer because the half-life of proGRP in the circulation is much longer than that of GRP. GRPR is also important in prostate cancer growth and progression in an androgen-dependent manner.
Chemical PropertiesBack Directory
[density ]

1.46±0.1 g/cm3(Predicted)
[storage temp. ]

−20°C
[solubility ]

H2OPeptide Solubility and Storage Guidelines:1.??Calculate the length of the peptide.2.??Calculate the overall charge of the entire peptide according to the following table:3.??Recommended solution:
[form ]

Powder
[color ]

White to off-white
[Water Solubility ]

Soluble to 1 mg/ml in water
[Sequence]

H-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Safety DataBack Directory
[WGK Germany ]

3
Hazard InformationBack Directory
[Description]

Gut-brain peptides are widely conserved in vertebrates, GRP is a neuropeptide that modulates the autonomic system. It is an anorexigenic factor in the brain, regulates male sexual function at the spinal cord level, conveys the itch sensation, and is also involved in many autonomic regulations in the brain. The expression of GRP is also a specific tumor marker for small cell lung cancer. It has the GXHWAVGHLM amide (X=N or S) sequence at its C-terminus.
[Uses]

GRP (gastrin releasing peptide) has been used for absorption/neutralization of anti-GRP antibody prior to the tyramide signal amplification (TSA) procedure.
[General Description]

GRP (gastrin releasing peptide) is the mammalian homolog of bombesin (BBS) and functions as a mitogen for multiple cancers, such as neuroblastoma. It is a ligand for GRPR (GRP receptor) and is expressed in a subtype of peptidergic dorsal root ganglion neurons.
[Biochem/physiol Actions]

GRP (gastrin releasing peptide) functions as an autocrine growth factor for nueroblastoma. It facilitates cell survival in PI3K/AKT (phosphatidylinositol-3-kinase/ v-Akt murine thymoma viral oncogene)-mediated manner and cell proliferation and angiogenesis in neuroblastoma. This peptide is involved in the release of gastrin and the control of gastric acid secretion and motor function. In patients with atopic dermatitis, the serum levels of this peptide are linked with pruritus.
[Clinical Use]

GRP mRNA is overexpressed in patients suffering from small cell lung cancer. Clinically, therefore, a higher level of circulating proGRP31–125 is a specific tumor marker for small cell lung cancer (higher than ~81.0 pg/mL in the plasma). In addition, intravenous infusions of GRP decrease spontaneous food intake in healthy men, suggesting GRP acts as a satiety signal in humans. GRP has not yet been used much clinically as a therapeutic agent.
[storage]

Store at -20°C
Spectrum DetailBack Directory
[Spectrum Detail]

GASTRIN RELEASING PEPTIDE, HUMAN(93755-85-2)MS
93755-85-2 suppliers list
Company Name: Shenzhen Nexconn Pharmatechs Ltd
Tel: +86-755-89396905 +86-15013857715 , +86-15013857715
Website: http://www.approvedhomemanagement.com/ShowSupplierProductsList31188/0.htm
Company Name: Cellmano Biotech Limited
Tel: 0551-65326643 18156095617 , 18156095617
Website: http://www.cellmano.com/
Company Name: career henan chemical co
Tel: +86-0371-86658258 +8613203830695 , +8613203830695
Website: www.coreychem.com
Company Name: Zhejiang J&C Biological Technology Co.,Limited
Tel: +1-2135480471 +1-2135480471 , +1-2135480471
Website: https://www.sarms4muscle.com
Company Name: Hangzhou Go Top Peptide Biotech
Tel: 0571-88211921
Website: http://www.gotopbio.com/
Company Name: InvivoChem
Tel: +1-708-310-1919 +1-13798911105 , +1-13798911105
Website: https://www.invivochem.com/
Company Name: Chengdu Youngshe Chemical Co., Ltd.
Tel: +8618108235634 , +8618108235634
Website: http://www.youngshechem.com/
Company Name: Nanjing TGpeptide
Tel: +86-13347807150 +86-13347807150 , +86-13347807150
Website: tgpeptides.com/index.aspx
Company Name: Changsha MOL Changes Biotechnology Co., Ltd.
Tel: +8619375158599 , +8619375158599
Website: www.molchanges.com
Company Name:   
Tel: 821-50328103-801 18930552037
Website: http://www.approvedhomemanagement.com/ShowSupplierProductsList13285/0.htm
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Website: http://www.glschina.com/
Company Name: Shanghai Hanhong Scientific Co.,Ltd.  
Tel: 021-54306202 13764082696
Website: https://www.hanhongsci.com
Company Name: Chemsky(shanghai)International Co.,Ltd.  
Tel: 021-50135380
Website: www.shchemsky.com
Company Name: Cellmano Biotech Limited  
Tel: 0551-65326643 18156095617
Website: https://www.cellmano.com
Company Name: BOC Sciences  
Tel: 1-631-485-4226; 16314854226
Website: https://www.bocsci.com
Company Name: MedChemexpress LLC  
Tel: 021-58955995
Website: www.medchemexpress.cn
Company Name: TargetMol Chemicals Inc.  
Tel: 021-021-33632979 15002134094
Website: https://www.targetmol.cn/
Company Name: Wuxi Zhongkun Biochemical Technology Co., Ltd.  
Tel: 0510-85629785 18013409632
Website: www.reading-chemicals.com
Tags:93755-85-2 Related Product Information

  • HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.